Lineage for d2j9ha2 (2j9h A:80-210)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736229Protein automated matches [226848] (11 species)
    not a true protein
  7. 1736246Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 1736357Domain d2j9ha2: 2j9h A:80-210 [205002]
    Other proteins in same PDB: d2j9ha1, d2j9hb1
    automated match to d1gssa1
    complexed with gtx; mutant

Details for d2j9ha2

PDB Entry: 2j9h (more details), 2.4 Å

PDB Description: crystal structure of human glutathione-s-transferase p1-1 cys-free mutant in complex with s-hexylglutathione at 2.4 a resolution
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d2j9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ha2 a.45.1.1 (A:80-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrakyisliytnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgsldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOPe Domain Coordinates for d2j9ha2:

Click to download the PDB-style file with coordinates for d2j9ha2.
(The format of our PDB-style files is described here.)

Timeline for d2j9ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j9ha1