Lineage for d2isya2 (2isy A:65-148)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740321Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1740322Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 1740323Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 1740359Protein Iron-dependent regulator [47983] (1 species)
  7. 1740360Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
    Uniprot Q50495
  8. 1740361Domain d2isya2: 2isy A:65-148 [137613]
    Other proteins in same PDB: d2isya1, d2isyb1
    automated match to d2isya2
    complexed with ni, po4

Details for d2isya2

PDB Entry: 2isy (more details), 1.96 Å

PDB Description: crystal structure of the nickel-activated two-domain iron-dependent regulator (ider)
PDB Compounds: (A:) iron-dependent repressor ider

SCOPe Domain Sequences for d2isya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isya2 a.76.1.1 (A:65-148) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgvasenlyfq

SCOPe Domain Coordinates for d2isya2:

Click to download the PDB-style file with coordinates for d2isya2.
(The format of our PDB-style files is described here.)

Timeline for d2isya2:

1740361
d2isya2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2isya1