Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
Protein Programmed cell death 4, PDCD4 [140815] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries) Uniprot Q61823 322-448! Uniprot Q61823 322-450 |
Domain d2iona1: 2ion A:322-450 [137575] 2nd MA3 domain complexed with gol |
PDB Entry: 2ion (more details), 1.57 Å
SCOPe Domain Sequences for d2iona1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iona1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk qlrdlcpsr
Timeline for d2iona1: