Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.18: MOA C-terminal domain-like [159846] (2 proteins) PfamB PB070855 |
Protein Agglutinin MOA [159847] (1 species) |
Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (2 PDB entries) Uniprot Q8X123 156-293 |
Domain d2ihoa2: 2iho A:156-293 [147682] Other proteins in same PDB: d2ihoa1 complexed with gal, nag |
PDB Entry: 2iho (more details), 2.41 Å
SCOPe Domain Sequences for d2ihoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihoa2 d.3.1.18 (A:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep qnggylndigydsymafy
Timeline for d2ihoa2: