SCOPe 2.07: Domain d2ihoa1: 2iho A:2-155

Lineage for d2ihoa1 (2iho A:2-155)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Agglutinin MOA, N-terminal domain [159152] (1 species)

7. Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159153] (2 PDB entries)
   Uniprot Q8X123 2-155

8. Domain d2ihoa1: 2iho A:2-155 [147681]
   Other proteins in same PDB: d2ihoa2
   complexed with gal, nag

Details for d2ihoa1

PDB Entry: 2iho, 2.41 Å

PDB Description: crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2ihoa1:

Sequence; same for both SEQRES and ATOM records:

>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
vdlvngdssdgakiagwtgtwdegnphqkwyfnr

Timeline for d2ihoa1:

• d2ihoa1 first appeared in SCOP 1.75
  
• d2ihoa1 appears in SCOPe 2.06
  
• d2ihoa1 appears in the current release, SCOPe 2.08