Lineage for d2ihoa1 (2iho A:2-155)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401664Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2401676Protein Agglutinin MOA, N-terminal domain [159152] (1 species)
  7. 2401677Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159153] (2 PDB entries)
    Uniprot Q8X123 2-155
  8. 2401682Domain d2ihoa1: 2iho A:2-155 [147681]
    Other proteins in same PDB: d2ihoa2
    complexed with gal, nag

Details for d2ihoa1

PDB Entry: 2iho (more details), 2.41 Å

PDB Description: crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2ihoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
vdlvngdssdgakiagwtgtwdegnphqkwyfnr

SCOPe Domain Coordinates for d2ihoa1:

Click to download the PDB-style file with coordinates for d2ihoa1.
(The format of our PDB-style files is described here.)

Timeline for d2ihoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ihoa2