Class b: All beta proteins [48724] (177 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (18 species) not a true protein |
Species Leishmania major [TaxId:5664] [187822] (1 PDB entry) |
Domain d2hqja_: 2hqj A: [165208] automated match to d1dywa_ complexed with po4 |
PDB Entry: 2hqj (more details), 2 Å
SCOPe Domain Sequences for d2hqja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqja_ b.62.1.1 (A:) automated matches {Leishmania major [TaxId: 5664]} mtnpkvffdisidnkaagrivmelyadtvpktaenfralctgekgkgrsgkplhykssvf hrvipnfmiqggdftrgngtggesiygttfrdesfsgkagrhtglgclsmanagpntngs qffictaatpwldgkhvvfgrvidgldvvkkverlgsssgktrsrivvsdcgevaadks
Timeline for d2hqja_: