Lineage for d2hqja_ (2hqj A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073956Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2073957Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2073958Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2074266Protein automated matches [190077] (18 species)
    not a true protein
  7. 2074325Species Leishmania major [TaxId:5664] [187822] (1 PDB entry)
  8. 2074326Domain d2hqja_: 2hqj A: [165208]
    automated match to d1dywa_
    complexed with po4

Details for d2hqja_

PDB Entry: 2hqj (more details), 2 Å

PDB Description: cyclophilin from leishmania major
PDB Compounds: (A:) cyclophilin

SCOPe Domain Sequences for d2hqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqja_ b.62.1.1 (A:) automated matches {Leishmania major [TaxId: 5664]}
mtnpkvffdisidnkaagrivmelyadtvpktaenfralctgekgkgrsgkplhykssvf
hrvipnfmiqggdftrgngtggesiygttfrdesfsgkagrhtglgclsmanagpntngs
qffictaatpwldgkhvvfgrvidgldvvkkverlgsssgktrsrivvsdcgevaadks

SCOPe Domain Coordinates for d2hqja_:

Click to download the PDB-style file with coordinates for d2hqja_.
(The format of our PDB-style files is described here.)

Timeline for d2hqja_: