Lineage for d2hqja1 (2hqj A:2-179)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2397680Protein automated matches [190077] (18 species)
    not a true protein
  7. 2397734Species Leishmania major [TaxId:5664] [187822] (1 PDB entry)
  8. 2397735Domain d2hqja1: 2hqj A:2-179 [165208]
    Other proteins in same PDB: d2hqja2
    automated match to d1dywa_
    complexed with po4

Details for d2hqja1

PDB Entry: 2hqj (more details), 2 Å

PDB Description: cyclophilin from leishmania major
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2hqja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqja1 b.62.1.1 (A:2-179) automated matches {Leishmania major [TaxId: 5664]}
tnpkvffdisidnkaagrivmelyadtvpktaenfralctgekgkgrsgkplhykssvfh
rvipnfmiqggdftrgngtggesiygttfrdesfsgkagrhtglgclsmanagpntngsq
ffictaatpwldgkhvvfgrvidgldvvkkverlgsssgktrsrivvsdcgevaadks

SCOPe Domain Coordinates for d2hqja1:

Click to download the PDB-style file with coordinates for d2hqja1.
(The format of our PDB-style files is described here.)

Timeline for d2hqja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hqja2