Lineage for d2h9ua_ (2h9u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957478Family d.68.6.0: automated matches [191549] (1 protein)
    not a true family
  6. 2957479Protein automated matches [190948] (3 species)
    not a true protein
  7. 2957480Species Aeropyrum pernix [TaxId:272557] [188545] (2 PDB entries)
  8. 2957481Domain d2h9ua_: 2h9u A: [165025]
    automated match to d1nfha_
    complexed with edo

Details for d2h9ua_

PDB Entry: 2h9u (more details), 2 Å

PDB Description: crystal structure of the archaea specific dna binding protein
PDB Compounds: (A:) DNA/RNA-binding protein Alba 2

SCOPe Domain Sequences for d2h9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9ua_ d.68.6.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
acegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfakn
ieikdikidsqeievqtpegqtrtrrvssieiclekagesa

SCOPe Domain Coordinates for d2h9ua_:

Click to download the PDB-style file with coordinates for d2h9ua_.
(The format of our PDB-style files is described here.)

Timeline for d2h9ua_: