SCOPe 2.08: Structural Classification of Proteins

PDB entry 2h9u

View 2h9u on RCSB PDB site
Description: Crystal structure of the archaea specific DNA binding protein
Class: DNA binding protein
Keywords: archaea, aeropyrum pernix, DNA binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-06-12, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: DNA/RNA-binding protein Alba 2
Species: Aeropyrum pernix [TaxId:272557]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9YAX2 (Start-101)
Domains in SCOPe 2.08: d2h9ua_
Heterogens: EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2h9uA (A:)
macegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfak
nieikdikidsqeievqtpegqtrtrrvssieiclekagesa

Sequence, based on observed residues (ATOM records): (download)

>2h9uA (A:)
acegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfakn
ieikdikidsqeievqtpegqtrtrrvssieiclekagesa