Lineage for d1nfha_ (1nfh A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.68: IF3-like [55199] (8 superfamilies)
beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
Superfamily d.68.6: AlbA-like [82704] (3 families) 
Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) 
Protein DNA-binding protein AlbA [82706] (4 species)
an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
Species Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries)
gene AF1956
Domain d1nfha_: 1nfh A: [91864]
Details for d1nfha_
PDB Entry: 1nfh (more details), 2.65 Å
PDB Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding
PDB Compounds: (A:) conserved hypothetical protein AF1956SCOPe Domain Sequences for d1nfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfha_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeoglobus fulgidus [TaxId: 2234]}
hvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvkei
kidteeleseqgrrsnvstieivlak
SCOPe Domain Coordinates for d1nfha_:
Click to download the PDB-style file with coordinates for d1nfha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nfha_:
- d1nfha_ first appeared in SCOP 1.67
- d1nfha_ appears in SCOPe 2.07
View in 3D
