Lineage for d2h79a_ (2h79 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748003Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)
  8. 1748023Domain d2h79a_: 2h79 A: [165003]
    automated match to d1nava_
    complexed with t3

Details for d2h79a_

PDB Entry: 2h79 (more details), 1.87 Å

PDB Description: crystal structure of human tr alpha bound t3 in orthorhombic space group
PDB Compounds: (A:) THRA protein

SCOPe Domain Sequences for d2h79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h79a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
argshmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspi
vsmpdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimsl
raavrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqa
vllmstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigach
asrflhckvecptelfpplflevfedq

SCOPe Domain Coordinates for d2h79a_:

Click to download the PDB-style file with coordinates for d2h79a_.
(The format of our PDB-style files is described here.)

Timeline for d2h79a_: