Lineage for d2h79a1 (2h79 A:148-408)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (155 PDB entries)
  8. 2336180Domain d2h79a1: 2h79 A:148-408 [165003]
    Other proteins in same PDB: d2h79a2
    automated match to d1nava_
    complexed with t3

Details for d2h79a1

PDB Entry: 2h79 (more details), 1.87 Å

PDB Description: crystal structure of human tr alpha bound t3 in orthorhombic space group
PDB Compounds: (A:) THRA protein

SCOPe Domain Sequences for d2h79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h79a1 a.123.1.1 (A:148-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsmpdg
dkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavry
dpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavllmst
drsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasrflh
ckvecptelfpplflevfedq

SCOPe Domain Coordinates for d2h79a1:

Click to download the PDB-style file with coordinates for d2h79a1.
(The format of our PDB-style files is described here.)

Timeline for d2h79a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h79a2