Lineage for d2giba1 (2gib A:270-366)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/betaSuperfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families) 
Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
C-terminal part of Pfam PF00937Protein Coronavirus nucleocapsid protein [143509] (2 species) Species SARS coronavirus [TaxId:227859] [143511] (2 PDB entries)
Uniprot P59595 270-366
Domain d2giba1: 2gib A:270-366 [135225]
complexed with so4
Details for d2giba1
PDB Entry: 2gib (more details), 1.75 Å
PDB Description: Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain
PDB Compounds: (A:) nucleocapsid proteinSCOPe Domain Sequences for d2giba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2giba1 d.254.1.2 (A:270-366) Coronavirus nucleocapsid protein {SARS coronavirus [TaxId: 227859]}
nvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtpsg
twltyhgaiklddkdpqfkdnvillnkhidayktfpp
SCOPe Domain Coordinates for d2giba1:
Click to download the PDB-style file with coordinates for d2giba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2giba1:
- d2giba1 first appeared in SCOP 1.73
- d2giba1 appears in SCOPe 2.04
- d2giba1 appears in SCOPe 2.06
- d2giba1 appears in the current release, SCOPe 2.08
View in 3D
