Lineage for d2giba1 (2gib A:270-366)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740956Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 740957Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families) (S)
  5. 740963Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (1 protein)
    C-terminal part of Pfam PF00937
  6. 740964Protein Coronavirus nucleocapsid protein [143509] (2 species)
  7. 740978Species SARS coronavirus [TaxId:227859] [143511] (1 PDB entry)
  8. 740979Domain d2giba1: 2gib A:270-366 [135225]
    complexed with so4

Details for d2giba1

PDB Entry: 2gib (more details), 1.75 Å

PDB Description: Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain
PDB Compounds: (A:) nucleocapsid protein

SCOP Domain Sequences for d2giba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2giba1 d.254.1.2 (A:270-366) Coronavirus nucleocapsid protein {SARS coronavirus [TaxId: 227859]}
nvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtpsg
twltyhgaiklddkdpqfkdnvillnkhidayktfpp

SCOP Domain Coordinates for d2giba1:

Click to download the PDB-style file with coordinates for d2giba1.
(The format of our PDB-style files is described here.)

Timeline for d2giba1: