Lineage for d2gfha1 (2gfh A:1-247)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
the insertion subdomain is a 4-helical bundle
Protein N-acylneuraminate-9-phosphatase NANP [142137] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [142138] (1 PDB entry)
Uniprot Q9CPT3 1-247
Domain d2gfha1: 2gfh A:1-247 [135096]
Other proteins in same PDB: d2gfha2
complexed with cl, edo, na, po4
Details for d2gfha1
PDB Entry: 2gfh (more details), 1.9 Å
PDB Description: Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 A resolution
PDB Compounds: (A:) haloacid dehalogenase-like hydrolase domain containing 4SCOPe Domain Sequences for d2gfha1:
Sequence, based on SEQRES records: (download)
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}
mglsrvravffdldntlidtagasrrgmlevikllqskyhykeeaeiicdkvqvklskec
fhpystcitdvrtshweeaiqetkggadnrklaeecyflwkstrlqhmiladdvkamlte
lrkevrlllltngdrqtqrekieacacqsyfdaiviggeqkeekpapsifyhccdllgvq
pgdcvmvgdtletdiqgglnaglkatvwinksgrvpltsspmphymvssvlelpallqsi
dckvsms
Sequence, based on observed residues (ATOM records): (download)
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}
mglsrvravffdldntlidtagasrrgmlevikllqskyhykeeaeiicdkvqvklskec
fhcitdvrtshweeaiqetkggadnrklaeecyflwkstrlqhmiladdvkamltelrke
vrlllltngdrqtqrekieacacqsyfdaiviggeqkeekpapsifyhccdllgvqpgdc
vmvgdtletdiqgglnaglkatvwinksgrvpltsspmphymvssvlelpallqsidckv
sms
SCOPe Domain Coordinates for d2gfha1:
Click to download the PDB-style file with coordinates for d2gfha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gfha1:
- d2gfha1 first appeared in SCOP 1.73
- d2gfha1 appears in SCOPe 2.06
- d2gfha1 appears in the current release, SCOPe 2.08
View in 3D
