Lineage for d2gfha1 (2gfh A:1-247)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148774Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 protein domains)
    the insertion subdomain is a 4-helical bundle
  6. 2148811Protein N-acylneuraminate-9-phosphatase NANP [142137] (1 species)
  7. 2148812Species Mouse (Mus musculus) [TaxId:10090] [142138] (1 PDB entry)
    Uniprot Q9CPT3 1-247
  8. 2148813Domain d2gfha1: 2gfh A:1-247 [135096]
    Other proteins in same PDB: d2gfha2
    complexed with cl, edo, na, po4

Details for d2gfha1

PDB Entry: 2gfh (more details), 1.9 Å

PDB Description: Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 A resolution
PDB Compounds: (A:) haloacid dehalogenase-like hydrolase domain containing 4

SCOPe Domain Sequences for d2gfha1:

Sequence, based on SEQRES records: (download)

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}
mglsrvravffdldntlidtagasrrgmlevikllqskyhykeeaeiicdkvqvklskec
fhpystcitdvrtshweeaiqetkggadnrklaeecyflwkstrlqhmiladdvkamlte
lrkevrlllltngdrqtqrekieacacqsyfdaiviggeqkeekpapsifyhccdllgvq
pgdcvmvgdtletdiqgglnaglkatvwinksgrvpltsspmphymvssvlelpallqsi
dckvsms

Sequence, based on observed residues (ATOM records): (download)

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}
mglsrvravffdldntlidtagasrrgmlevikllqskyhykeeaeiicdkvqvklskec
fhcitdvrtshweeaiqetkggadnrklaeecyflwkstrlqhmiladdvkamltelrke
vrlllltngdrqtqrekieacacqsyfdaiviggeqkeekpapsifyhccdllgvqpgdc
vmvgdtletdiqgglnaglkatvwinksgrvpltsspmphymvssvlelpallqsidckv
sms

SCOPe Domain Coordinates for d2gfha1:

Click to download the PDB-style file with coordinates for d2gfha1.
(The format of our PDB-style files is described here.)

Timeline for d2gfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gfha2