Lineage for d2gc6a1 (2gc6 A:297-425)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the restSuperfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) 
Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein) Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species) Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries) 
Domain d2gc6a1: 2gc6 A:297-425 [134952]
Other proteins in same PDB: d2gc6a2
automated match to d2gc6a1
complexed with so4; mutant
Details for d2gc6a1
PDB Entry: 2gc6 (more details), 1.9 Å
PDB Description: s73a mutant of l. casei fpgs
PDB Compounds: (A:) Folylpolyglutamate synthaseSCOPe Domain Sequences for d2gc6a1:
Sequence, based on SEQRES records: (download)
>d2gc6a1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg
Sequence, based on observed residues (ATOM records): (download)
>d2gc6a1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagilyaamadrltaafs
tvylvpvpgtpralrlkdswqealaaslndvpdqpivitgslylasavrqtllg
SCOPe Domain Coordinates for d2gc6a1:
Click to download the PDB-style file with coordinates for d2gc6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gc6a1:
- d2gc6a1 first appeared in SCOP 1.73
- d2gc6a1 appears in SCOPe 2.03
- d2gc6a1 appears in SCOPe 2.05
- d2gc6a1 appears in the current release, SCOPe 2.08
View in 3D
