Lineage for d2g8oa_ (2g8o A:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) Protein Thymidylate synthase [55833] (7 species) Species Escherichia coli [TaxId:562] [55834] (65 PDB entries) 
Domain d2g8oa_: 2g8o A: [134779]
automated match to d1an5a_
complexed with cb3, ump
Details for d2g8oa_
PDB Entry: 2g8o (more details), 1.3 Å
PDB Description: High resolution structure of Escherichia coli thymidylate synthase ternary complex with dUMP and a cofactor analog, CB3717
PDB Compounds: (A:) Thymidylate synthaseSCOPe Domain Sequences for d2g8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8oa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOPe Domain Coordinates for d2g8oa_:
Click to download the PDB-style file with coordinates for d2g8oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g8oa_:
- d2g8oa_ first appeared in SCOP 1.73, called d2g8oa1
- d2g8oa_ appears in SCOPe 2.01
- d2g8oa_ does not appear in SCOPe 2.03
View in 3D
