Lineage for d2g84a1 (2g84 A:1-189)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (6 families) 
contains extra C-terminal strand 5, order 21345Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
strand 5 is parallel to strand 4
Protein Putative deaminase NE0047 [142833] (1 species) Species Nitrosomonas europaea [TaxId:915] [142834] (8 PDB entries)
Uniprot Q82Y41 1-189
Domain d2g84a1: 2g84 A:1-189 [134766]
complexed with bme, edo, na, zn
Details for d2g84a1
PDB Entry: 2g84 (more details), 1.4 Å
PDB Description: cytidine and deoxycytidylate deaminase zinc-binding region from nitrosomonas europaea.
PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding regionSCOPe Domain Sequences for d2g84a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac
ngviynarc
SCOPe Domain Coordinates for d2g84a1:
Click to download the PDB-style file with coordinates for d2g84a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g84a1:
- d2g84a1 first appeared in SCOP 1.73
- d2g84a1 appears in SCOPe 2.02
- d2g84a1 appears in SCOPe 2.04
- d2g84a1 appears in the current release, SCOPe 2.08
View in 3D
