Lineage for d2fxka1 (2fxk A:182-368)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.50: Macro domain-like [52948] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the restSuperfamily c.50.1: Macro domain-like [52949] (4 families) 
Family c.50.1.2: Macro domain [89724] (7 proteins)
found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
Protein Histone macro-H2a1.1 [142547] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [142549] (6 PDB entries)
Uniprot O75367 179-367! Uniprot O75367 181-371
Domain d2fxka1: 2fxk A:182-368 [134323]
isoform 1
Details for d2fxka1
PDB Entry: 2fxk (more details), 2.54 Å
PDB Description: Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form A)
PDB Compounds: (A:) H2A histone family, member Y isoform 1SCOPe Domain Sequences for d2fxka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxka1 c.50.1.2 (A:182-368) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]}
gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefvea
vlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdk
klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
emaklda
SCOPe Domain Coordinates for d2fxka1:
Click to download the PDB-style file with coordinates for d2fxka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fxka1:
- d2fxka1 first appeared in SCOP 1.73
- d2fxka1 appears in SCOPe 2.05
- d2fxka1 appears in SCOPe 2.07
- d2fxka1 appears in the current release, SCOPe 2.08
View in 3D
