SCOPe 2.08: Domain d2fxka1: 2fxk A:182-368

Lineage for d2fxka1 (2fxk A:182-368)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Histone macro-H2a1.1 [142547] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142549] (6 PDB entries)
   Uniprot O75367 179-367! Uniprot O75367 181-371

8. Domain d2fxka1: 2fxk A:182-368 [134323]
   isoform 1

Details for d2fxka1

PDB Entry: 2fxk, 2.54 Å

PDB Description: Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form A)

PDB Compounds: (A:) H2A histone family, member Y isoform 1

SCOPe Domain Sequences for d2fxka1:

Sequence; same for both SEQRES and ATOM records:

>d2fxka1 c.50.1.2 (A:182-368) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]}
gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefvea
vlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdk
klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
emaklda

Timeline for d2fxka1:

• d2fxka1 first appeared in SCOP 1.73
  
• d2fxka1 appears in SCOPe 2.07