Lineage for d2fx0a2 (2fx0 A:77-198)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Hemolysin II regulatory protein, HlyIIR [140889] (1 species) Species Bacillus cereus [TaxId:1396] [140890] (1 PDB entry)
Uniprot Q7X506 77-198
Domain d2fx0a2: 2fx0 A:77-198 [134270]
Other proteins in same PDB: d2fx0a1
Details for d2fx0a2
PDB Entry: 2fx0 (more details), 2.4 Å
PDB Description: Crystal Structure of HlyIIR, a Hemolysin II transcriptional Regulator
PDB Compounds: (A:) hemolysin II regulatory proteinSCOPe Domain Sequences for d2fx0a2:
Sequence, based on SEQRES records: (download)
>d2fx0a2 a.121.1.1 (A:77-198) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidslgtnetndtnhewmpedlvsriisalt
dk
Sequence, based on observed residues (ATOM records): (download)
>d2fx0a2 a.121.1.1 (A:77-198) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidsdlvsriisaltdk
SCOPe Domain Coordinates for d2fx0a2:
Click to download the PDB-style file with coordinates for d2fx0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fx0a2:
- d2fx0a2 first appeared in SCOP 1.73
- d2fx0a2 appears in SCOPe 2.04
- d2fx0a2 appears in SCOPe 2.06
- d2fx0a2 appears in the current release, SCOPe 2.08
View in 3D
