Lineage for d2fx0a2 (2fx0 A:77-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727942Protein Hemolysin II regulatory protein, HlyIIR [140889] (1 species)
  7. 2727943Species Bacillus cereus [TaxId:1396] [140890] (1 PDB entry)
    Uniprot Q7X506 77-198
  8. 2727944Domain d2fx0a2: 2fx0 A:77-198 [134270]
    Other proteins in same PDB: d2fx0a1

Details for d2fx0a2

PDB Entry: 2fx0 (more details), 2.4 Å

PDB Description: Crystal Structure of HlyIIR, a Hemolysin II transcriptional Regulator
PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2fx0a2:

Sequence, based on SEQRES records: (download)

>d2fx0a2 a.121.1.1 (A:77-198) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidslgtnetndtnhewmpedlvsriisalt
dk

Sequence, based on observed residues (ATOM records): (download)

>d2fx0a2 a.121.1.1 (A:77-198) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidsdlvsriisaltdk

SCOPe Domain Coordinates for d2fx0a2:

Click to download the PDB-style file with coordinates for d2fx0a2.
(The format of our PDB-style files is described here.)

Timeline for d2fx0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fx0a1