Lineage for d2f76x1 (2f76 X:1-94)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273122Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1273123Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1273155Family a.61.1.3: Mason-Pfizer monkey virus matrix protein [47845] (1 protein)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02337
  6. 1273156Protein Mason-Pfizer monkey virus matrix protein [47846] (1 species)
  7. 1273157Species Simian Mason-Pfizer virus [TaxId:11855] [47847] (2 PDB entries)
  8. 1273158Domain d2f76x1: 2f76 X:1-94 [133085]
    automatically matched to d1bax__

Details for d2f76x1

PDB Entry: 2f76 (more details)

PDB Description: solution structure of the m-pmv wild type matrix protein (p10)
PDB Compounds: (X:) Core protein p10

SCOPe Domain Sequences for d2f76x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f76x1 a.61.1.3 (X:1-94) Mason-Pfizer monkey virus matrix protein {Simian Mason-Pfizer virus [TaxId: 11855]}
mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
dcfqdyyntfgpekvpvtafsywnlikelidkke

SCOPe Domain Coordinates for d2f76x1:

Click to download the PDB-style file with coordinates for d2f76x1.
(The format of our PDB-style files is described here.)

Timeline for d2f76x1: