SCOPe 2.08: Domain d2f76x_: 2f76 X:

Lineage for d2f76x_ (2f76 X:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.3: Mason-Pfizer monkey virus matrix protein [47845] (1 protein)
   the C-terminal helix region is missing(?)
   automatically mapped to Pfam PF02337

6. Protein Mason-Pfizer monkey virus matrix protein [47846] (1 species)

7. Species Simian Mason-Pfizer virus [TaxId:11855] [47847] (3 PDB entries)

8. Domain d2f76x_: 2f76 X: [133085]
   automated match to d2f76x1

Details for d2f76x_

PDB Entry: 2f76

PDB Description: solution structure of the m-pmv wild type matrix protein (p10)

PDB Compounds: (X:) Core protein p10

SCOPe Domain Sequences for d2f76x_:

Sequence; same for both SEQRES and ATOM records:

>d2f76x_ a.61.1.3 (X:) Mason-Pfizer monkey virus matrix protein {Simian Mason-Pfizer virus [TaxId: 11855]}
mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
dcfqdyyntfgpekvpvtafsywnlikelidkkevnpqvm

Timeline for d2f76x_:

• d2f76x_ first appeared in SCOP 1.73, called d2f76x1
  
• d2f76x_ appears in SCOPe 2.07