SCOP 1.73: Domain d2f76x1: 2f76 X:1-94

Lineage for d2f76x1 (2f76 X:1-94)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.3: Mason-Pfizer monkey virus matrix protein [47845] (1 protein)
   the C-terminal helix region is missing(?)

6. Protein Mason-Pfizer monkey virus matrix protein [47846] (1 species)

7. Species Simian Mason-Pfizer virus [TaxId:11855] [47847] (2 PDB entries)

8. Domain d2f76x1: 2f76 X:1-94 [133085]
   automatically matched to d1bax__

Details for d2f76x1

PDB Entry: 2f76

PDB Description: solution structure of the m-pmv wild type matrix protein (p10)

PDB Compounds: (X:) Core protein p10

SCOP Domain Sequences for d2f76x1:

Sequence; same for both SEQRES and ATOM records:

>d2f76x1 a.61.1.3 (X:1-94) Mason-Pfizer monkey virus matrix protein {Simian Mason-Pfizer virus [TaxId: 11855]}
mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
dcfqdyyntfgpekvpvtafsywnlikelidkke

Timeline for d2f76x1:

• d2f76x1 is new in SCOP 1.73
  
• d2f76x1 appears in SCOP 1.75
  
• d2f76x1 appears in the current release, SCOPe 2.08, called d2f76x_