Lineage for d2f5ke_ (2f5k E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785119Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1785273Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. 1785283Protein automated matches [190429] (1 species)
    not a true protein
  7. 1785284Species Human (Homo sapiens) [TaxId:9606] [187320] (2 PDB entries)
  8. 1785288Domain d2f5ke_: 2f5k E: [132999]
    Other proteins in same PDB: d2f5ka1
    automated match to d2efia1

Details for d2f5ke_

PDB Entry: 2f5k (more details), 2.2 Å

PDB Description: crystal structure of the chromo domain of human mrg15
PDB Compounds: (E:) MORF-related gene 15 isoform 1

SCOPe Domain Sequences for d2f5ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5ke_ b.34.13.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeq

SCOPe Domain Coordinates for d2f5ke_:

Click to download the PDB-style file with coordinates for d2f5ke_.
(The format of our PDB-style files is described here.)

Timeline for d2f5ke_: