| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.3: Chromo barrel domain [117157] (4 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
| Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species) MORF-related gene 15 isoform 1 |
| Species Human (Homo sapiens) [TaxId:9606] [141226] (2 PDB entries) Uniprot Q9UBU8 6-88 |
| Domain d2efia1: 2efi A:13-95 [146814] automatically matched to d2f5ka1 |
PDB Entry: 2efi (more details)
SCOPe Domain Sequences for d2efia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efia1 b.34.13.3 (A:13-95) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeqyaegk
Timeline for d2efia1: