SCOP 1.73: Domain d2f5ke1: 2f5k E:6-83

Lineage for d2f5ke1 (2f5k E:6-83)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.3: Chromo barrel domain [117157] (3 proteins)
   typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain

6. Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species)
   MORF-related gene 15 isoform 1

7. Species Human (Homo sapiens) [TaxId:9606] [141226] (1 PDB entry)

8. Domain d2f5ke1: 2f5k E:6-83 [132999]
   automatically matched to 2F5K A:6-88

Details for d2f5ke1

PDB Entry: 2f5k, 2.2 Å

PDB Description: crystal structure of the chromo domain of human mrg15

PDB Compounds: (E:) MORF-related gene 15 isoform 1

SCOP Domain Sequences for d2f5ke1:

Sequence; same for both SEQRES and ATOM records:

>d2f5ke1 b.34.13.3 (E:6-83) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeq

Timeline for d2f5ke1:

• d2f5ke1 is new in SCOP 1.73
  
• d2f5ke1 appears in SCOP 1.75
  
• d2f5ke1 appears in the current release, SCOPe 2.08, called d2f5ke_