![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order |
![]() | Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) ![]() contains metal-binding site on the bundle surface surrounded by loops |
![]() | Family a.213.1.2: DinB-like [140603] (4 proteins) Pfam PF05163 |
![]() | Protein Hypothetical protein BH3987 [140604] (1 species) family assignment by RPS BLAST hit; similar to YfiT subunit fold and metal-binding site, but different dimerisation mode |
![]() | Species Bacillus halodurans [TaxId:86665] [140605] (1 PDB entry) Uniprot Q9RC77 1-141 |
![]() | Domain d2f22a1: 2f22 A:1-141 [132795] complexed with na, ni |
PDB Entry: 2f22 (more details), 1.42 Å
SCOPe Domain Sequences for d2f22a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f22a1 a.213.1.2 (A:1-141) Hypothetical protein BH3987 {Bacillus halodurans [TaxId: 86665]} mdtngvlyaanmtnalakeipeskwdiqlipelgtlrklfihivrvrdvyrdglktgsik fpgrlasdehrlldelersmeelvfefkqttfnsikmgenylsimellgtviqhegihqg qyyvalkqsginlpkqwvqdw
Timeline for d2f22a1: