Lineage for d2f22b_ (2f22 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737633Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 2737634Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 2737642Family a.213.1.2: DinB-like [140603] (4 proteins)
    Pfam PF05163
  6. 2737647Protein Hypothetical protein BH3987 [140604] (1 species)
    family assignment by RPS BLAST hit; similar to YfiT subunit fold and metal-binding site, but different dimerisation mode
  7. 2737648Species Bacillus halodurans [TaxId:86665] [140605] (1 PDB entry)
    Uniprot Q9RC77 1-141
  8. 2737650Domain d2f22b_: 2f22 B: [132796]
    automated match to d2f22a1
    complexed with na, ni

Details for d2f22b_

PDB Entry: 2f22 (more details), 1.42 Å

PDB Description: crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution
PDB Compounds: (B:) bh3987

SCOPe Domain Sequences for d2f22b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f22b_ a.213.1.2 (B:) Hypothetical protein BH3987 {Bacillus halodurans [TaxId: 86665]}
mdtngvlyaanmtnalakeipeskwdiqlipelgtlrklfihivrvrdvyrdglktgsik
fpgrlasdehrlldelersmeelvfefkqttfnsikmgenylsimellgtviqhegihqg
qyyvalkqsginlpkqwvqdwhm

SCOPe Domain Coordinates for d2f22b_:

Click to download the PDB-style file with coordinates for d2f22b_.
(The format of our PDB-style files is described here.)

Timeline for d2f22b_: