SCOPe 2.08: Domain d2f22b_: 2f22 B:

Lineage for d2f22b_ (2f22 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.2: DinB-like [140603] (4 proteins)
   Pfam PF05163

6. Protein Hypothetical protein BH3987 [140604] (1 species)
   family assignment by RPS BLAST hit; similar to YfiT subunit fold and metal-binding site, but different dimerisation mode

7. Species Bacillus halodurans [TaxId:86665] [140605] (1 PDB entry)
   Uniprot Q9RC77 1-141

8. Domain d2f22b_: 2f22 B: [132796]
   automated match to d2f22a1
   complexed with na, ni

Details for d2f22b_

PDB Entry: 2f22, 1.42 Å

PDB Description: crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution

PDB Compounds: (B:) bh3987

SCOPe Domain Sequences for d2f22b_:

Sequence; same for both SEQRES and ATOM records:

>d2f22b_ a.213.1.2 (B:) Hypothetical protein BH3987 {Bacillus halodurans [TaxId: 86665]}
mdtngvlyaanmtnalakeipeskwdiqlipelgtlrklfihivrvrdvyrdglktgsik
fpgrlasdehrlldelersmeelvfefkqttfnsikmgenylsimellgtviqhegihqg
qyyvalkqsginlpkqwvqdwhm

Timeline for d2f22b_:

• d2f22b_ first appeared in SCOP 1.73, called d2f22b1
  
• d2f22b_ appears in SCOPe 2.07