Lineage for d2euca1 (2euc A:1-113)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.249: YfmB-like [140687] (1 superfamily)
5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain (81593)Superfamily a.249.1: YfmB-like [140688] (1 family) 
automatically mapped to Pfam PF11486Family a.249.1.1: YfmB-like [140689] (1 protein) Protein Hypothetical protein YfmB [140690] (1 species) Species Bacillus subtilis [TaxId:1423] [140691] (1 PDB entry)
Uniprot O34626 1-113
Domain d2euca1: 2euc A:1-113 [132382]
Details for d2euca1
PDB Entry: 2euc (more details), 2.5 Å
PDB Description: crystal structure of yfmb from bacillus subtilis. nesg target sr324
PDB Compounds: (A:) Hypothetical protein yfmBSCOPe Domain Sequences for d2euca1:
Sequence, based on SEQRES records: (download)
>d2euca1 a.249.1.1 (A:1-113) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfv
Sequence, based on observed residues (ATOM records): (download)
>d2euca1 a.249.1.1 (A:1-113) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsaayhlfv
SCOPe Domain Coordinates for d2euca1:
Click to download the PDB-style file with coordinates for d2euca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2euca1:
- d2euca1 first appeared in SCOP 1.73
- d2euca1 appears in SCOPe 2.04
- d2euca1 appears in SCOPe 2.06
- d2euca1 appears in the current release, SCOPe 2.08
View in 3D
