Lineage for d2dwka_ (2dwk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738386Fold a.256: RUN domain-like [140740] (1 superfamily)
    multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other
  4. 2738387Superfamily a.256.1: RUN domain-like [140741] (1 family) (S)
  5. 2738388Family a.256.1.1: RUN domain [140742] (2 proteins)
    Pfam PF02759
  6. 2738393Protein automated matches [190616] (1 species)
    not a true protein
  7. 2738394Species Mouse (Mus musculus) [TaxId:10090] [187644] (2 PDB entries)
  8. 2738395Domain d2dwka_: 2dwk A: [163729]
    automated match to d2cxfa1

Details for d2dwka_

PDB Entry: 2dwk (more details), 2 Å

PDB Description: Crystal structure of the RUN domain of mouse Rap2 interacting protein x
PDB Compounds: (A:) Protein RUFY3

SCOPe Domain Sequences for d2dwka_:

Sequence, based on SEQRES records: (download)

>d2dwka_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv

Sequence, based on observed residues (ATOM records): (download)

>d2dwka_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv

SCOPe Domain Coordinates for d2dwka_:

Click to download the PDB-style file with coordinates for d2dwka_.
(The format of our PDB-style files is described here.)

Timeline for d2dwka_: