PDB entry 2dwk

View 2dwk on RCSB PDB site
Description: Crystal structure of the RUN domain of mouse Rap2 interacting protein x
Class: protein binding
Keywords: RUN domain, effector, Rap2, bundle, protein binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-08-15, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein RUFY3
    Species: Mus musculus [TaxId:10090]
    Gene: Rufy3, D5Bwg0860e, Ripx
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D394 (7-End)
      • modified residue (7)
      • modified residue (12)
      • modified residue (15)
      • modified residue (17)
      • modified residue (50)
      • modified residue (114)
      • modified residue (122)
      • modified residue (142-143)
      • modified residue (166)
    Domains in SCOPe 2.08: d2dwka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2dwkA (A:)
gssgssgmanermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglk
akktflgqnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkkls
eymkalinkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqvgvid

    Sequence, based on observed residues (ATOM records): (download) 
    >2dwkA (A:)
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv