Class a: All alpha proteins [46456] (290 folds) |
Fold a.256: RUN domain-like [140740] (1 superfamily) multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other |
Superfamily a.256.1: RUN domain-like [140741] (1 family) |
Family a.256.1.1: RUN domain [140742] (2 proteins) Pfam PF02759 |
Protein automated matches [190616] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187644] (2 PDB entries) |
Domain d2dwka_: 2dwk A: [163729] automated match to d2cxfa1 |
PDB Entry: 2dwk (more details), 2 Å
SCOPe Domain Sequences for d2dwka_:
Sequence, based on SEQRES records: (download)
>d2dwka_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv
>d2dwka_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv
Timeline for d2dwka_: