SCOPe 2.08: Domain d2dwka_: 2dwk A:

Lineage for d2dwka_ (2dwk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.256: RUN domain-like [140740] (1 superfamily)
   multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other

4. Superfamily a.256.1: RUN domain-like [140741] (1 family)

5. Family a.256.1.1: RUN domain [140742] (2 proteins)
   Pfam PF02759

6. Protein automated matches [190616] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187644] (2 PDB entries)

8. Domain d2dwka_: 2dwk A: [163729]
   automated match to d2cxfa1

Details for d2dwka_

PDB Entry: 2dwk, 2 Å

PDB Description: Crystal structure of the RUN domain of mouse Rap2 interacting protein x

PDB Compounds: (A:) Protein RUFY3

SCOPe Domain Sequences for d2dwka_:

Sequence, based on SEQRES records:

>d2dwka_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv

Sequence, based on observed residues (ATOM records):

>d2dwka_ a.256.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv

Timeline for d2dwka_:

• d2dwka_ first appeared in SCOPe 2.01
  
• d2dwka_ appears in SCOPe 2.07