Lineage for d2dpka1 (2dpk A:370-502)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2039949Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2039950Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
    Pfam PF03160
  6. 2039951Protein Sodium/calcium exchanger 1 [141074] (1 species)
  7. 2039952Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries)
    Uniprot P23685 402-534! Uniprot P23685 403-541! Uniprot P23685 533-724
  8. 2039953Domain d2dpka1: 2dpk A:370-502 [131616]
    Other proteins in same PDB: d2dpka2
    1st CalX-beta domain
    complexed with ca, epe, gai

Details for d2dpka1

PDB Entry: 2dpk (more details), 2.5 Å

PDB Description: The Crystal Structure of the Primary Ca2+ Sensor of the Na+/Ca2+ Exchanger
PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d2dpka1:

Sequence, based on SEQRES records: (download)

>d2dpka1 b.1.27.1 (A:370-502) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgileanhvsalaclgsp
statvtifdddha

Sequence, based on observed residues (ATOM records): (download)

>d2dpka1 b.1.27.1 (A:370-502) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedenflvhlsnvkvssesalaclgspstatvtifdddh
a

SCOPe Domain Coordinates for d2dpka1:

Click to download the PDB-style file with coordinates for d2dpka1.
(The format of our PDB-style files is described here.)

Timeline for d2dpka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dpka2