SCOPe 2.08: Domain d2dpka1: 2dpk A:370-502

Lineage for d2dpka1 (2dpk A:370-502)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
   Pfam PF03160

6. Protein Sodium/calcium exchanger 1 [141074] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [141075] (3 PDB entries)
   Uniprot P23685 402-534! Uniprot P23685 403-541! Uniprot P23685 533-724

8. Domain d2dpka1: 2dpk A:370-502 [131616]
   Other proteins in same PDB: d2dpka2
   1st CalX-beta domain
   complexed with ca, epe, gai

Details for d2dpka1

PDB Entry: 2dpk, 2.5 Å

PDB Description: The Crystal Structure of the Primary Ca2+ Sensor of the Na+/Ca2+ Exchanger

PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d2dpka1:

Sequence, based on SEQRES records:

>d2dpka1 b.1.27.1 (A:370-502) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgileanhvsalaclgsp
statvtifdddha

Sequence, based on observed residues (ATOM records):

>d2dpka1 b.1.27.1 (A:370-502) Sodium/calcium exchanger 1 {Dog (Canis familiaris) [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedenflvhlsnvkvssesalaclgspstatvtifdddh
a

Timeline for d2dpka1:

• d2dpka1 first appeared in SCOP 1.73
  
• d2dpka1 appears in SCOPe 2.07