PDB entry 2dpk

View 2dpk on RCSB PDB site
Description: The Crystal Structure of the Primary Ca2+ Sensor of the Na+/Ca2+ Exchanger
Class: metal transport
Keywords: Calcium sensory domain, beta-sandwich, cis-proline, beta-bulge, METAL TRANSPORT
Deposited on 2006-05-12, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium/calcium exchanger 1
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23685 (12-End)
      • expression tag (9-11)
    Domains in SCOPe 2.08: d2dpka1, d2dpka2
  • Heterogens: CA, GAI, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dpkA (A:)
    mrgshhhhhhgipvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtan
    agsdyeftegtvvfkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgilea
    nhvsalaclgspstatvtifdddhagiftfee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dpkA (A:)
    hgipvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyefte
    gtvvfkpgetqkeirvgiidddifeedenflvhlsnvkvssesalaclgspstatvtifd
    ddha