Lineage for d2cxfa1 (2cxf A:83-249)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928676Fold a.256: RUN domain-like [140740] (1 superfamily)
    multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other
  4. 928677Superfamily a.256.1: RUN domain-like [140741] (1 family) (S)
  5. 928678Family a.256.1.1: RUN domain [140742] (2 proteins)
    Pfam PF02759
  6. 928679Protein Rap2 interacting protein X (RUFY3) [140743] (1 species)
  7. 928680Species Mouse (Mus musculus) [TaxId:10090] [140744] (2 PDB entries)
    Uniprot Q9D394 65-231
  8. 928681Domain d2cxfa1: 2cxf A:83-249 [131004]

Details for d2cxfa1

PDB Entry: 2cxf (more details), 3.07 Å

PDB Description: RUN domain of Rap2 interacting protein x, crystallized in C2 space group
PDB Compounds: (A:) rap2 interacting protein x

SCOPe Domain Sequences for d2cxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxfa1 a.256.1.1 (A:83-249) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedlds

SCOPe Domain Coordinates for d2cxfa1:

Click to download the PDB-style file with coordinates for d2cxfa1.
(The format of our PDB-style files is described here.)

Timeline for d2cxfa1: