PDB entry 2cxf

View 2cxf on RCSB PDB site
Description: RUN domain of Rap2 interacting protein x, crystallized in C2 space group
Class: protein binding
Keywords: helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-06-29, released 2005-12-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: 0.237
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rap2 interacting protein x
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D394 (7-End)
      • modified residue (7)
      • modified residue (12)
      • modified residue (15)
      • modified residue (17)
      • modified residue (50)
      • modified residue (114)
      • modified residue (122)
      • modified residue (142-143)
      • modified residue (166)
    Domains in SCOPe 2.01: d2cxfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cxfA (A:)
    gssgssgmanermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglk
    akktflgqnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkkls
    eymkalinkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqvgvid
    fsmylkdgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxfA (A:)
    manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
    qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
    nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedlds