Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Bacterioferritin comigratory protein [142377] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries) Uniprot Q9YA14 4-163 |
Domain d2cx3a1: 2cx3 A:5-163 [130969] Other proteins in same PDB: d2cx3a2, d2cx3b3, d2cx3c3, d2cx3d3 |
PDB Entry: 2cx3 (more details), 2.64 Å
SCOPe Domain Sequences for d2cx3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx3a1 c.47.1.10 (A:5-163) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]} velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav fivkpdgtvaykwvtdnplnepdydevvreankiagelv
Timeline for d2cx3a1: