PDB entry 2cx3

View 2cx3 on RCSB PDB site
Description: Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-1 crystal)
Class: oxidoreductase
Keywords: oxidoreductase, antioxidant enzyme, reactive oxygen species, thioredoxin fold, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-27, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.206
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin comigratory protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE2125
    Database cross-references and differences (RAF-indexed):
    • GB NP_148402
      • modified residue (59)
      • modified residue (117)
    Domains in SCOPe 2.08: d2cx3a1, d2cx3a2
  • Chain 'B':
    Compound: bacterioferritin comigratory protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE2125
    Database cross-references and differences (RAF-indexed):
    • GB NP_148402
      • modified residue (59)
      • modified residue (117)
    Domains in SCOPe 2.08: d2cx3b2, d2cx3b3
  • Chain 'C':
    Compound: bacterioferritin comigratory protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE2125
    Database cross-references and differences (RAF-indexed):
    • GB NP_148402
      • modified residue (59)
      • modified residue (117)
    Domains in SCOPe 2.08: d2cx3c2, d2cx3c3
  • Chain 'D':
    Compound: bacterioferritin comigratory protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE2125
    Database cross-references and differences (RAF-indexed):
    • GB NP_148402
      • modified residue (59)
      • modified residue (117)
    Domains in SCOPe 2.08: d2cx3d2, d2cx3d3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cx3A (A:)
    mkglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkm
    aqlekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmva
    kravfivkpdgtvaykwvtdnplnepdydevvreankiagelva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx3A (A:)
    lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql
    ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra
    vfivkpdgtvaykwvtdnplnepdydevvreankiagelv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cx3B (B:)
    mkglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkm
    aqlekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmva
    kravfivkpdgtvaykwvtdnplnepdydevvreankiagelva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx3B (B:)
    glvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaq
    lekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakr
    avfivkpdgtvaykwvtdnplnepdydevvreankiagelv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cx3C (C:)
    mkglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkm
    aqlekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmva
    kravfivkpdgtvaykwvtdnplnepdydevvreankiagelva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx3C (C:)
    lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql
    ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra
    vfivkpdgtvaykwvtdnplnepdydevvreankiagelv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cx3D (D:)
    mkglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkm
    aqlekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmva
    kravfivkpdgtvaykwvtdnplnepdydevvreankiagelva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx3D (D:)
    lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql
    ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra
    vfivkpdgtvaykwvtdnplnepdydevvreankiagelv