Lineage for d2cu6a1 (2cu6 A:6-96)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/betaSuperfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) 
similar putative active site with a conserved cysteine residue
Family d.52.8.2: PaaD-like [117922] (3 proteins)
Pfam PF01883; DUF59
Protein Hypothetical protein TTHB138 [143230] (1 species) Species Thermus thermophilus [TaxId:274] [143231] (1 PDB entry)
Uniprot Q53W28 6-96
Domain d2cu6a1: 2cu6 A:6-96 [130803]
Other proteins in same PDB: d2cu6b_
Details for d2cu6a1
PDB Entry: 2cu6 (more details), 2 Å
PDB Description: Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
PDB Compounds: (A:) dTDP-4-keto-L-rhamnose reductase-related ProteinSCOPe Domain Sequences for d2cu6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]}
pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr
qalsrlpgveevevevtfeppwtlarlseka
SCOPe Domain Coordinates for d2cu6a1:
Click to download the PDB-style file with coordinates for d2cu6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cu6a1:
- d2cu6a1 first appeared in SCOP 1.73
- d2cu6a1 appears in SCOPe 2.06
- d2cu6a1 appears in the current release, SCOPe 2.08
View in 3D
