Lineage for d2cu6a1 (2cu6 A:6-96)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190902Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2191101Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 2191112Family d.52.8.2: PaaD-like [117922] (3 proteins)
    Pfam PF01883; DUF59
  6. 2191117Protein Hypothetical protein TTHB138 [143230] (1 species)
  7. 2191118Species Thermus thermophilus [TaxId:274] [143231] (1 PDB entry)
    Uniprot Q53W28 6-96
  8. 2191119Domain d2cu6a1: 2cu6 A:6-96 [130803]
    Other proteins in same PDB: d2cu6b_

Details for d2cu6a1

PDB Entry: 2cu6 (more details), 2 Å

PDB Description: Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
PDB Compounds: (A:) dTDP-4-keto-L-rhamnose reductase-related Protein

SCOPe Domain Sequences for d2cu6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]}
pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr
qalsrlpgveevevevtfeppwtlarlseka

SCOPe Domain Coordinates for d2cu6a1:

Click to download the PDB-style file with coordinates for d2cu6a1.
(The format of our PDB-style files is described here.)

Timeline for d2cu6a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cu6b_