Lineage for d2cu3a1 (2cu3 A:1-63)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.3: MoaD/ThiS [54285] (5 families) 
possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
Family d.15.3.2: ThiS [54289] (4 proteins) Protein Uncharacterised protein TTHA0675 [159929] (1 species)
probable ThiS homologueSpecies Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
Uniprot Q5SKG8 1-63
Domain d2cu3a1: 2cu3 A:1-63 [146428]
complexed with cd
Details for d2cu3a1
PDB Entry: 2cu3 (more details), 1.7 Å
PDB Description: Crystal structure of TT1568 from Thermus thermophilus HB8
PDB Compounds: (A:) unknown function proteinSCOPe Domain Sequences for d2cu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqg
SCOPe Domain Coordinates for d2cu3a1:
Click to download the PDB-style file with coordinates for d2cu3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cu3a1:
- d2cu3a1 first appeared in SCOP 1.75
- d2cu3a1 appears in SCOPe 2.02
- d2cu3a1 appears in the current release, SCOPe 2.08
View in 3D
