SCOP 1.75: Domain d2cu3a1: 2cu3 A:1-63

Lineage for d2cu3a1 (2cu3 A:1-63)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (4 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.2: ThiS [54289] (4 proteins)

6. Protein Uncharacterised protein TTHA0675 [159929] (1 species)
   probable ThiS homologue

7. Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
   Uniprot Q5SKG8 1-63

8. Domain d2cu3a1: 2cu3 A:1-63 [146428]
   complexed with cd

Details for d2cu3a1

PDB Entry: 2cu3, 1.7 Å

PDB Description: Crystal structure of TT1568 from Thermus thermophilus HB8

PDB Compounds: (A:) unknown function protein

SCOP Domain Sequences for d2cu3a1:

Sequence; same for both SEQRES and ATOM records:

>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqg

Timeline for d2cu3a1:

• d2cu3a1 is new in SCOP 1.75
  
• d2cu3a1 appears in SCOPe 2.01
  
• d2cu3a1 appears in the current release, SCOPe 2.08