| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
| Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
| Protein Kinesin-like protein kif13b [141239] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141240] (1 PDB entry) Uniprot Q9NQT8 1684-1771 |
| Domain d2cowa1: 2cow A:7-94 [130686] |
PDB Entry: 2cow (more details)
SCOPe Domain Sequences for d2cowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]}
gqalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgknd
gsiggkqyfrcnpgygllvrpsrvrrat
Timeline for d2cowa1: