SCOP 1.73: Domain d2cowa1: 2cow A:7-94

Lineage for d2cowa1 (2cow A:7-94)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (1 family)

5. Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
   Pfam PF01302

6. Protein Kinesin-like protein kif13b [141239] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141240] (1 PDB entry)

8. Domain d2cowa1: 2cow A:7-94 [130686]

Details for d2cowa1

PDB Entry: 2cow

PDB Description: solution structure of the cap-gly domain in human kinesin-like protein kif13b

PDB Compounds: (A:) Kinesin-like protein KIF13B

SCOP Domain Sequences for d2cowa1:

Sequence; same for both SEQRES and ATOM records:

>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]}
gqalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgknd
gsiggkqyfrcnpgygllvrpsrvrrat

Timeline for d2cowa1:

• d2cowa1 is new in SCOP 1.73
  
• d2cowa1 appears in SCOP 1.75
  
• d2cowa1 appears in the current release, SCOPe 2.08