Lineage for d2cowa1 (2cow A:7-94)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665899Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 665900Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 665926Protein Kinesin-like protein kif13b [141239] (1 species)
  7. 665927Species Human (Homo sapiens) [TaxId:9606] [141240] (1 PDB entry)
  8. 665928Domain d2cowa1: 2cow A:7-94 [130686]

Details for d2cowa1

PDB Entry: 2cow (more details)

PDB Description: solution structure of the cap-gly domain in human kinesin-like protein kif13b
PDB Compounds: (A:) Kinesin-like protein KIF13B

SCOP Domain Sequences for d2cowa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]}
gqalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgknd
gsiggkqyfrcnpgygllvrpsrvrrat

SCOP Domain Coordinates for d2cowa1:

Click to download the PDB-style file with coordinates for d2cowa1.
(The format of our PDB-style files is described here.)

Timeline for d2cowa1: