![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (1 family) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (10 proteins) Pfam PF01302 |
![]() | Protein Kinesin-like protein kif13b [141239] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141240] (1 PDB entry) |
![]() | Domain d2cowa1: 2cow A:7-94 [130686] |
PDB Entry: 2cow (more details)
SCOP Domain Sequences for d2cowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} gqalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgknd gsiggkqyfrcnpgygllvrpsrvrrat
Timeline for d2cowa1: