Lineage for d2ckga_ (2ckg A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.7: Adenain-like [54054] (6 proteins)
Pfam PF02902; Ulp1 protease family
Protein Sentrin-specific protease 1 [142862] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142863] (7 PDB entries)
Uniprot Q9P0U3 419-643
Domain d2ckga_: 2ckg A: [163429]
automated match to d2ckha1
Details for d2ckga_
PDB Entry: 2ckg (more details), 2.45 Å
PDB Description: the structure of senp1 sumo-2 co-complex suggests a structural basis for discrimination between sumo paralogues during processing
PDB Compounds: (A:) sentrin-specific protease 1SCOPe Domain Sequences for d2ckga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckga_ d.3.1.7 (A:) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmn
gsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
SCOPe Domain Coordinates for d2ckga_:
Click to download the PDB-style file with coordinates for d2ckga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ckga_:
- d2ckga_ first appeared in SCOPe 2.01
- d2ckga_ appears in SCOPe 2.05
- d2ckga_ appears in SCOPe 2.07
- d2ckga_ appears in the current release, SCOPe 2.08
View in 3D
