| Class g: Small proteins [56992] (94 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
| Protein STIP1 homology and U box-containing protein 1, STUB1 [144224] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [144225] (2 PDB entries) Uniprot Q9WUD1 225-304! Uniprot Q9WUD1 227-301 |
| Domain d2c2vs1: 2c2v S:227-301 [129694] Other proteins in same PDB: d2c2vb_, d2c2vc1, d2c2ve_, d2c2vf_, d2c2vh_, d2c2vi_, d2c2vk_, d2c2vl_, d2c2vt_, d2c2vu_, d2c2vv_ |
PDB Entry: 2c2v (more details), 2.9 Å
SCOPe Domain Sequences for d2c2vs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2vs1 g.44.1.2 (S:227-301) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
mkevidafisengwv
Timeline for d2c2vs1: